P450:CYP51

From Metabolomics.JP
(Difference between revisions)
Jump to: navigation, search
(New page: =51 Family= CYP51s were originally all called CYP51, because only one gene was found per species and they all seemed to be in this one conserved family. However, rice had many CYP51s in a...)
 
m
Line 34: Line 34:
 
&&CYP51G1&&Oryza sativa (rice)&&GenEMBL aaaa01012243.1 Indica rice genome  
 
&&CYP51G1&&Oryza sativa (rice)&&GenEMBL aaaa01012243.1 Indica rice genome  
 
&&CYP51G1&&Pinus taeda (pine)&&GenEMBL BF517195.1 AW984874.1 AW626637.1 C-term fragments
 
&&CYP51G1&&Pinus taeda (pine)&&GenEMBL BF517195.1 AW984874.1 AW626637.1 C-term fragments
&&CYP51&&C-term&&LXHDVLAXXDVLYRCIKEALRLHPPLIVLLRSNHRDFTVTAKDGKDYVIPKGHVVATSPAFANRLPHIFKNPDT
 
 
&&CYP51G1&&Sorghum bicolor&&GenEMBL U74319
 
&&CYP51G1&&Sorghum bicolor&&GenEMBL U74319
 
&&CYP51G1&&Triticum aestivum (wheat)&&GenEMBL Y09291 (1655bp)
 
&&CYP51G1&&Triticum aestivum (wheat)&&GenEMBL Y09291 (1655bp)

Revision as of 16:22, 19 June 2009

51 Family

CYP51s were originally all called CYP51, because only one gene was found per species and they all seemed to be in this one conserved family. However, rice had many CYP51s in at least two sequence groups, so subfamilies have been designated for CYP51s. These are not the typical subfamilies, but only one subfamily is created for each major taxonomic group.

  • CYP51A for animals,
  • CYP51B for bacteria,
  • CYP51C for Chromista,
  • CYP51D for Dictyostelium,
  • CYP51E for Euglenozoa,
  • CYP51F for fungi.

Those groups with only one CYP51 per species are all called by one name:

  • CYP51A1 is for all animal CYP51s since they are orthologous.
  • The same is true for CYP51B, C, D, E and F.
  • CYP51G (green plants) and CYP51Hs (monocots only so far) have individual sequence numbers.
  • CYP51G1 refers to the typical CYP51 14 alpha-demethylase gene in plants, usually in one copy per species. A few species have extra CYP51G sequences.
  • CYP51H is another group of related sequences that probably do not

have the same function as CYP51G. There are many of these in rice.

ID Species Description
CYP51G1 Brassicaceae Brassicales GenEMBL AC007296 comp(52507-54167)
CYP51G1 GenEMBL ESTs BI717817 BU649818 BI726293 BM001590 BI718677 AV642299
CYP51G1 JGI model estExt_Genewise1.C_30095$$Volca1
CYP51G1 EuGene.1200010398$$MicpuN3 at JGI
CYP51G1 estExt_fgenesh1_pg.C_100222$$MicpuC2 at JGI
CYP51G1 e_gw1.11.00.152.1$$Ostta4 at JGI
CYP51G1 e_gwEuk.11.159.1$$Ost9901_3 at JGI
CYP51G1 Funariaceae Funariales ESTs BJ585158.1 BJ591215.1 BJ592754.1 BJ963427.1 BJ165255.1 BJ157286.1
CYP51G1v1 Solanaceae Solanales GenEMBL AF116915.1
CYP51G1v2 Solanaceae Solanales GenEMBL AY065641.1
CYP51G1 Caricaceae Brassicales supercontig_119:252784,254990
CYP51G1 Vitaceae Vitales AM475390.2, CAAP02000381.1
CYP51G1 Poaceae Poales GenEMBL AB025047
CYP51G1 Poaceae Poales GenEMBL aaaa01012243.1 Indica rice genome
CYP51G1 Pinaceae Coniferales GenEMBL BF517195.1 AW984874.1 AW626637.1 C-term fragments
CYP51G1 Poaceae Poales GenEMBL U74319
CYP51G1 Poaceae Poales GenEMBL Y09291 (1655bp)
CYP51G1 Poaceae Poales GenEMBL Y09292 (1231bp)
CYP51G1 Poaceae Poales GenEMBL T12664 (EST fragment)
CYP51G1 Poaceae Poales No accession number
CYP51G1 Salicaceae Malpighiales
CYP51G1 Solanaceae Solanales AY552551
CYP51G1
  • Cucumis melo subsp. melo Piel de Sapo Pinyonet (melon, Cucurbitales)
Cucurbitaceae Cucurbitales AM722680 AM721153.2
CYP51G1 Pedaliaceae Lamiales No accession number
CYP51G1 Malvaceae Malvales DQ122177
CYP51G1 Ebenaceae Ericales DC586067.1, DC585117.1
CYP51G1 Rubiaceae Gentianales EE193728.1
CYP51G1 Magnoliaceae Magnoliales FD493672.1 FD498629.1
CYP51G1 Aristolochiaceae Piperales FD760060.1 ends do not match
CYP51G1 Zamiaceae Cycadales FD774927.1 FD769109.1
CYP51G2 Brassicaceae Brassicales GenEMBL AC002329 Complete sequence
CYP51G3 Poaceae Poales GenEMBL AY022669.1
CYP51G4P Poaceae Poales GenEMBL AP003866.1b
CYP51G5 Salicaceae Malpighiales
CYP51G6 Vitaceae Vitales CAAP02000072.1
CYP51G7P Vitaceae Vitales CAAP02006913.1
CYP51G1 Fabaceae Fabales GenEMBL DQ335779 also GenPept ABC59074
CYP51G1 Fabaceae Fabales DQ340249
CYP51G1 Selaginellaceae Selaginellales traces 724390578, 890688186, 719688188
CYP51G1 Pteridaceae Polypodiales GenEMBL CV734775.1 CV734906.1 ESTs
CYP51G1 Asteraceae Asterales GenEMBL DW082409 DY973804.1 ESTs
CYP51G1 Euphorbiaceae Malpighiales GenEMBL AASG01019728 (WGS)
CYP51G1 Myrtaceae Myrtales GenEMBL CT983870 EST
CYP51G1 GenEMBL DR174877
CYP51G1
  • Malus x domestica (Royal Gala apple, Rosales)
Rosaceae Rosales EB130903.1 EST
CYP51G1 Rutaceae Sapindales GenEMBL DY300918
CYP51G1 Malvaceae Malvales GenEMBL DT574647
CYP51G1 Aizoaceae Caryophyllales GenEMBL CA839975
CYP51G1 Ranunculaceae Ranunculales GenEMBL DT767027.1 EST
CYP51G1 Fagaceae Fagales GenEMBL DN949857.1
CYP51G1 Pteridaceae Polypodiales BP920200
CYP51H1 Poaceae Poales GenEMBL AP005448.1b AP005188.2c
CYP51H2P Poaceae Poales GenEMBL AP005188.2b AP005448.1a
CYP51H3 Poaceae Poales GenEMBL AP005188.2a
CYP51H4 Poaceae Poales GenEMBL AP004890.1
CYP51H5 Poaceae Poales GenEMBL AP004090.1
CYP51H6 Poaceae Poales GenEMBL AC108875.1a
CYP51H7 Poaceae Poales GenEMBL AC108875.1b
CYP51H8 Poaceae Poales GenEMBL AC108875.1c
CYP51H9 Poaceae Poales GenEMBL AP003866.1a
CYP51H10 Poaceae Poales GenEMBL DQ680852
CYP51H11 Poaceae Poales No accession number
CYP51H12 Poaceae Poales EU954990
CYP55B1 See Chlamy page
Personal tools
Namespaces

Variants
Actions
Navigation
metabolites
Toolbox